Alpha-2-HS-glycoprotein, isoform CRA_a

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2-HS-glycoprotein, isoform CRA_a
  • GlycoProtDB: GPDB0004735
  • UniProt ID: Q3UEK9
  • Gene Symbol: Ahsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 99 17406563
22823882
2 156 17406563
22823882
23002422
3 176 17406563
22823882
23002422

Sequence

MKSLVLLLCFAQLWGCQSAPQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0