Alpha 1,4-galactosyltransferase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha 1,4-galactosyltransferase
  • GlycoProtDB: GPDB0004746
  • UniProt ID: Q3UF00
  • Gene Symbol: A4galt
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 209 23002422

Sequence

MGISCSHLEETMSKPPDCLLRMLRGTPRQRVFTFFIISFKFMFLISILIYWHTVGAPKDQREYSLPVDFSCPQLAFPRVSAPGNIFFLETSDRTSPNFLFMCSVESAARAHPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGIQSRYVLNGAFLAFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPPEAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARYCPTTHRAMKMYL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0