Carboxylic ester hydrolase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carboxylic ester hydrolase
  • GlycoProtDB: GPDB0004850
  • UniProt ID: Q3UN14
  • Gene Symbol: Ces1e
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 276 17406563
22823882

Sequence

MCLSALILVSLAAFTAGAGHPSSPPMVDTVQGKVLGKYISLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSSVKNATSYPPMCFQDPVTGQIVNDLLTNRKEKIPLQFSEDCLYLNIYTPADLTKSDRLPVMVWIHGGGLVLGGASTYDGLVLSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIAKFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFQRAISESGVALTAGLVKKNTRPLAEKIAVISGCKNTTSAAMVHCLRQKTEEELLGTTLKLNLFKLDLHGDSRQSHPFVPTVLDGVLLPKMPEEILAEKNFNTVPYIVGINKQEFGWILPTMMNYPPSDVKLDQMTAMSLLKKSSFLLNLPEDAIAVAIEKYLRDKDYTGRNKDQLLELIGDVVFGVPSVIVSRGHRDAGAPTYMYEFQYSPSFSSEMKPDTVVGDHGDEIYSVFGAPILRGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWTELLAKKQLPTEHTEL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0