Amino acid transporter

Entry of glycoprotein extracted from GlycoProtDB


Summary
Amino acid transporter
  • GlycoProtDB: GPDB0004910
  • UniProt ID: Q3US35
  • Gene Symbol: Slc1a4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 201 17406563
22823882
23002422
2 206 17406563
22823882
23002422

Sequence

MEKSGETNGYLDGTQAEPAAGPRTPETAMGKSQRCASFFRRHALVLLTVSGVLVGAGMGAALRGLQLTRTQITYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASSLGRLGGIAVAYFGLTTLSASALAVALAFIIKPGAGAQTLQSSSLGLENSGPPPVSKETVDSFLDLLRNLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTKEKIHVVTDVEGMNILGLVLFALVLGVALKKLGPEGEDLIRFFNSFNEATMVLVSWIMWYVPIGIMFLIGSKIVEMKDIVMLVTSLGKYIFASMLGHVIHGGIVLPLVYFAFTRKNPFTFLLGLLTPFATAFATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVDLNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLSLILAVDWIVDRTTTVVNVEGDALGAGILNHLNQKVVKKGEQELQEVKVEAIPNSKSEEETSPLVTHQNPAGPVAIAPELESKESVL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0