CD209b antigen, isoform CRA_a

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD209b antigen, isoform CRA_a
  • GlycoProtDB: GPDB0004933
  • UniProt ID: Q3UTX5
  • Gene Symbol: Cd209b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 112 23002422
2 141 23002422

Sequence

MSDSTEAKMQPLSSMDDDELMVSGSRYSIKSSRLRPNSGIKCLAGCSGHSQVPLVLQLLSFLFLAGLLLIILFQVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0