11B-hydroxysteroid dehydrogenase type 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
11B-hydroxysteroid dehydrogenase type 1
  • GlycoProtDB: GPDB0005122
  • UniProt ID: Q4JHD9
  • Gene Symbol: Hsd11b1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 162 17406563
22823882
23002422

Sequence

MAVMKNYLLPILVLFLAYYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMFVSN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0