C920025E04Rik protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
C920025E04Rik protein
  • GlycoProtDB: GPDB0005169
  • UniProt ID: Q52L73
  • Gene Symbol: C920025E04Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 106 17406563
22823882
23002422

Sequence

MLLFAHLLQLLVSATVPTQSSSHSLRYFHTAMSRPGLGEPRFIVVGYVDDTQFVSFDSDSENPKMEPRARWMEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSKDESHTLQWMYGCDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTATDFASQISKHKSEMVDEAHQQRAYLQGPCVEWLHTYLRLGALVHWAISPALCRS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0