CD90.1

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD90.1
  • GlycoProtDB: GPDB0005176
  • UniProt ID: Q53YX2
  • Gene Symbol: Thy1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 42 17406563
22823882
2 94 17406563
22823882
23002422

Sequence

MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELRVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0