Carboxypeptidase A3, mast cell

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carboxypeptidase A3, mast cell
  • GlycoProtDB: GPDB0005183
  • UniProt ID: Q542E3
  • Gene Symbol: Cpa3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 242 22823882

Sequence

MRFFLLMAVIYTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILKNTS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0