CD34 antigen, isoform CRA_b

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD34 antigen, isoform CRA_b
  • GlycoProtDB: GPDB0005190
  • UniProt ID: Q543B6
  • Gene Symbol: Cd34
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 246 22823882

Sequence

MQVHRDTRAGLLLPWRWVALCLMSLLHLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENGTGQATSRNGHSARQHVVADTEL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0