CD86 antigen

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD86 antigen
  • GlycoProtDB: GPDB0005249
  • UniProt ID: Q549Q9
  • Gene Symbol: Cd86
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 92 23002422
2 146 22823882
23002422
3 154 22823882
23002422

Sequence

MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0