Brain cDNA, clone MNCb-5810, similar to Mus musculus tissue inhibitor of metalloproteinase 3 (Timp3), mRNA

Entry of glycoprotein extracted from GlycoProtDB


Summary
Brain cDNA, clone MNCb-5810, similar to Mus musculus tissue inhibitor of metalloproteinase 3 (Timp3), mRNA
  • GlycoProtDB: GPDB0005252
  • UniProt ID: Q54AE5
  • Gene Symbol: Timp3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 207 22823882

Sequence

MTPWLGLVVLLSCWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0