CRS1C-2

Entry of glycoprotein extracted from GlycoProtDB


Summary
CRS1C-2
  • GlycoProtDB: GPDB0005304
  • UniProt ID: Q5ERJ0
  • Gene Symbol: Gm14851
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 100 22823882

Sequence

MKTLVLLSALALLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFLWCRKCPVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0