CH2-domain (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CH2-domain (Fragment)
  • GlycoProtDB: GPDB0005336
  • UniProt ID: Q5R3X8
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 67 17406563
22823882

Sequence

APNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0