Alpha-1 type I procollagen (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1 type I procollagen (Fragment)
  • GlycoProtDB: GPDB0005412
  • UniProt ID: Q60785
  • Gene Symbol: Col1a1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 226 17406563
22823882

Sequence

PRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGTPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGDRYYRADDANVVRDRDLAVDATLKSLSQQIENIRSPXSSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMTDGFPFEYGSEGSDPTDVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIELRGEGNSRFTYSRVVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPDQEFGLDIGPXCFV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0