ADAM 4 protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
ADAM 4 protein (Fragment)
  • GlycoProtDB: GPDB0005416
  • UniProt ID: Q60815
  • Gene Symbol: Adam4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 366 22823882

Sequence

FGVWKSKEFARFEPLQLFSLHQRPKNTDYGSFQNGLCNPNWGYITYVGKNHLFLAGSFLAHAVGHLLDVSHDTPGCVCFRRSSCLMDEFPTLHDMISNCSHNELHRRIHDWDPCLSLELKTAKEVNMYEVPRCGNKRVEASEKCDCGSVKDCTTDKCCEVNCEFTQGSSCAAGGCCLSCKFAPTGTICRDKNGICDLPEYCSGASEHCPGNFYIMDGTPCSPLAVCIAGNCSDRHLQCQALFGYQVKDGSPACYNELNVKGDRFGNCGIGIIRGGSQPVPCQKEDVFCGMIHCDGVSHIPGGGEHTTFYHLKVQDVKEEQCFGYDAHHGTELPEMGLVVDGATCGPGKYCKAQRCVAHPTLNFNCNISSCNFRGVCNNKGNCHCVRGWQPPHCLQIGKGGSTNSGPPPTTQKKHQAEIHVSANRLIVILSIRMILILASILLGAVLKAIFVSETTEEEQHSAVNRQLTSYQTI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0