B7-2 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
B7-2 protein
  • GlycoProtDB: GPDB0005465
  • UniProt ID: Q61238
  • Gene Symbol: Cd86
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 97 23002422
2 151 22823882
23002422
3 159 22823882
23002422

Sequence

MYVIKTCATCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0