Apolipoprotein C-IV

Entry of glycoprotein extracted from GlycoProtDB


Summary
Apolipoprotein C-IV
  • GlycoProtDB: GPDB0005466
  • UniProt ID: Q61268
  • Gene Symbol: Apoc4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 107 17406563
22823882
23002422

Sequence

MSLLRCRPRDLPSVSLSVLFLVSFVASMSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCKDRTQG

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0