Basic domain/leucine zipper transcription factor (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Basic domain/leucine zipper transcription factor (Fragment)
  • GlycoProtDB: GPDB0005472
  • UniProt ID: Q61340
  • Gene Symbol: Gnptab
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 43 22823882

Sequence

ILTTQKAYESLVSPVTPLPQADVPFEDVPKEKRFPKIRRHDVNATGRFQEEVKIPRVNISLLPKEAQVRLSNLDLQLERGDITLKGYNLSKSALLRSFLGNSLDTKIKPQARTDETKGNLEVPQENPSHRRPHGFAGEHRSERWTAPAETVTVKGRDHALNPPPVLETNARLAQPTLGVTVSKENLSPLIVPPESHLPKEEESDRAEGNAVPVKELVPGRRCSRIIQAFCPGKKKKYFQDLLDAEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFHEVDTDQSGVLSDREIRTLATRIHDLPLTCRI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0