Biliary glycoprotein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Biliary glycoprotein
  • GlycoProtDB: GPDB0005473
  • UniProt ID: Q61351
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 199 23002422
2 206 17406563
22823882
23002422
3 210 17406563
22823882
23002422
4 226 23002422
5 375 17406563
22823882
23002422

Sequence

MELASAHLHKGQVPWVGLLLTASLLASWSPPTTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTVKDTGVYTIEMTDENFRRTEATVQFHVHQLLLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCLVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0