Alpha-1-acid glycoprotein (AGP) (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1-acid glycoprotein (AGP) (Fragment)
  • GlycoProtDB: GPDB0005506
  • UniProt ID: Q61613
  • Gene Symbol: Orm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 21 22823882

Sequence

SQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELQEVFQKAVTHVGMDESEIIFVDWKKDRCS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0