ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  • GlycoProtDB: GPDB0005623
  • UniProt ID: Q64277
  • Gene Symbol: Bst1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 59 22823882
23002422
2 185 22823882

Sequence

MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLISLLVALASSSQA

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0