B7-2 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
B7-2 protein
  • GlycoProtDB: GPDB0005633
  • UniProt ID: Q64381
  • Gene Symbol: B7-2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 139 23002422
2 193 22823882
23002422
3 201 22823882
23002422

Sequence

MAKTIRRLSVAFLTLSDRGPHYKILLPLPHKGWTPGLTHNASLYCASIILKNTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0