2-hydroxyacylsphingosine 1-beta-galactosyltransferase

Entry of glycoprotein extracted from GlycoProtDB


Summary
2-hydroxyacylsphingosine 1-beta-galactosyltransferase
  • GlycoProtDB: GPDB0005654
  • UniProt ID: Q64676
  • Gene Symbol: Ugt8
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 78 17406563
22823882
2 442 17406563
22823882

Sequence

MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRIGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVSGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGARHLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIYRKIKSLWSKNEHSTVNGHYQNGIRNGKYKGNGRVKHEKKVR

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0