Cathepsin L (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cathepsin L (Fragment)
  • GlycoProtDB: GPDB0005744
  • UniProt ID: Q6LAF5
  • Gene Symbol: Ctsl
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 87 17406563
22823882
2 134 17406563
22823882

Sequence

CGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSW

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0