Cathepsin B (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cathepsin B (Fragment)
  • GlycoProtDB: GPDB0005745
  • UniProt ID: Q6LAF6
  • Gene Symbol: Ctsb
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 104 22823882

Sequence

CGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTKKGLVSGGVYDSHIGCLPYTIPPCEHHVNGSRPPMHGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAAN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0