Alpha 4 integrin (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha 4 integrin (Fragment)
  • GlycoProtDB: GPDB0005939
  • UniProt ID: Q78E20
  • Gene Symbol: Itga4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 5 22823882

Sequence

QPGENGSIVTCGHRWKNIFYMKSDNKLPTGICYVMPSDLRTELSKRMAPCYKDYTRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGTVFVYNITTNQYKAFVDRQNQVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIDENELNIVYEMKGKKLGSYFG

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0