Cd1d1 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cd1d1 protein
  • GlycoProtDB: GPDB0005959
  • UniProt ID: Q7TMK5
  • Gene Symbol: Cd1d1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 38 17406563
22823882
23002422

Sequence

MRYLPRLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0