Carbohydrate sulfotransferase 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carbohydrate sulfotransferase 2
  • GlycoProtDB: GPDB0006077
  • UniProt ID: Q80WV3
  • Gene Symbol: Chst2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 152 17406563
22823882

Sequence

MSRSSPRALPPGALPRPLPAAPAAVQRALLPPWPRRAGRRWPASPLGMKVFRRKALVLCAGYALLLVLTMLNLLDYKWHKEPLQQCNPDGPLGAAVGAAGAGWGRPGSPPAAPPRAHSRMDPRTPYRPPAAGVGAVPAAAAGSAGAAASLGNATRGTRGGGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLKDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGMGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0