Adam3 protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adam3 protein (Fragment)
  • GlycoProtDB: GPDB0006143
  • UniProt ID: Q810R6
  • Gene Symbol: Adam3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 64 22823882

Sequence

TPPWQSQQPHHAALIPSPLIPRPSDRCRQRRRNTTSADHSTRENRHQHPGCQNDKFGNCHGRCNYSAIFCGKAVCYWNFAEVIQTEKYDVQYTYLGGQVCVSAHLRSQTGTRDDTYVHDGTVCGSGQVCFRGDCLRVHVLRGTRECEADDKCQGHGICNNLNNCQCESGFAPPECDMTPSSPGGSMDDGFWLPFDKSTPLIFKRHGLKYKKVLLISFYILLPFLVVLAFMAVKRMIGKRLAKQNISKALEHKEEAFNRGSMNPGVVSGGNTDQNLMTVPGSFNSYAYHGNTDQNFMTVPGSFNSYSYHGNTDQNFMTVPGSFNSYSYQDVPYYRSIPEDGNDSQQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0