Cell cycle control protein 50B

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell cycle control protein 50B
  • GlycoProtDB: GPDB0006204
  • UniProt ID: Q8BHG3
  • Gene Symbol: Tmem30b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 145 22823882
2 171 17406563
22823882
3 213 17406563
22823882
23002422
4 273 17406563
22823882
23002422
5 286 17406563
22823882
23002422

Sequence

MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGIKELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYLYYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIVMGFVMLVVYIRYQDQDDDDNDDE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0