Adenosine monophosphate-protein transferase FICD

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adenosine monophosphate-protein transferase FICD
  • GlycoProtDB: GPDB0006220
  • UniProt ID: Q8BIX9
  • Gene Symbol: Ficd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 275 17406563
22823882

Sequence

MILMPMASVVAVAEPKWVSVWGRFLWMALLSMALGSLLALLLPLGVVEEHCLAVLRGFHLLRSKLDRAQPVVPKCTSLCTELSVSSRDAGLLTVKTTASPAGKLEAKAALNQALEMKRQGKRGKAHKLFLHALKMDPGFVDALNEFGIFSEEDKDIIQADYLYTRALTISPFHEKALVNRDRTLPLVEEIDQRYFSVIDSKVKKVMSIPKGSSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTMDDMLEIHRRVLGYVDPVEAGRFRRTQVLVGHHIPPHPRDVEKQMQEFTQWLNSEDAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEVANEGDVRPFIRFIAKCTEVTLDTLLLATTEYSVALPEAQPNHSGFKETLPVRP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0