Cell adhesion molecule 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell adhesion molecule 2
  • GlycoProtDB: GPDB0006271
  • UniProt ID: Q8BLQ9
  • Gene Symbol: Cadm2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 51 17406563
22823882
2 211 17406563
22823882
3 287 17406563
22823882
4 291 17406563
22823882

Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQALTLTCESKGKPLPEPVLWTKDGAELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTAPVTTSVTITTSPSTSASSSSRRDPNSLAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0