9530003J23Rik protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
9530003J23Rik protein
  • GlycoProtDB: GPDB0006285
  • UniProt ID: Q8BM26
  • Gene Symbol: 9530003J23Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 62 17406563
22823882

Sequence

MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0