C-type lectin domain family 4 member G

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 4 member G
  • GlycoProtDB: GPDB0006321
  • UniProt ID: Q8BNX1
  • Gene Symbol: Clec4g
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 73 23002422
2 93 23002422
3 246 17406563
22823882

Sequence

MNTGEYNKLGSAIEEVSRGQLGRWECYKQRLFFLVLALLVATVLWALILSTLLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY

Feature


Pathway

Associated pathways from Reactome


MCAW-DB (Glycan Recognition Profile) Images

MCAW-DB is a database whereby users can view the multiple alignment analysis results obtained from the MCAW tool, which can computationally find common glycan substructures among a group of glycan structures. The data in MCAW-DB are analysis results of glycan array experiments; those glycans having higher binding affinity to glycan binding proteins (GBPs) have been analyzed and can be viewed as “glycan recognition profiles”. Currently, this database provides published analysis results of glycan array data from the Consortium for Functional Glycomics (CFG).

3104

Image from MCAW-DB

3133

Image from MCAW-DB




Copyright © 2019    GlyCosmos Portal v1.2.0