Bis(5'-adenosyl)-triphosphatase enpp4

Entry of glycoprotein extracted from GlycoProtDB


Summary
Bis(5'-adenosyl)-triphosphatase enpp4
  • GlycoProtDB: GPDB0006382
  • UniProt ID: Q8BTJ4
  • Gene Symbol: Enpp4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 131 22823882
23002422
2 148 22823882
23002422
3 156 22823882
23002422
4 169 23002422
5 279 17406563
22823882
23002422
6 330 22823882
23002422

Sequence

MFNMKILVIPLFWGLVTGYKGNSSDSSAPRLLLVSFDGFRADYLKSYDLPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSVTKKHFSESNDKDPFWWNGAEPIWVTNQLQENRSSAAAMWPGTDVPIHNITASYFMNYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIGDIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYSVIDLTPVAAILPKINVTEVYDKLKRCNPHMNVYLKEAIPNRFYYQHSSRIQPIILVAEEGWTITLNKSSFKLGDHGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGTLSHTKCLLVDQWCINLPEAIGIVVSALLVLTMLTGLMIFMRSRASTSRPFSRLQLQEDDDDPLID

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0