Acid phosphatase type 7

Entry of glycoprotein extracted from GlycoProtDB


Summary
Acid phosphatase type 7
  • GlycoProtDB: GPDB0006418
  • UniProt ID: Q8BX37
  • Gene Symbol: Acp7
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 404 22823882

Sequence

MSPFLGGWLFFCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWAPARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEQRYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLIEKQFRWLENDLQKANKNRVARPWIITMGHRPMYCSNADLDDCTRHESRVRKGLHGKLFGLEDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSLESPYTNPRGPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKIVDDVWVVRPLLGRMMYH

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0