Calcium-activated potassium channel subunit beta-1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Calcium-activated potassium channel subunit beta-1
  • GlycoProtDB: GPDB0006591
  • UniProt ID: Q8CAE3
  • Gene Symbol: Kcnmb1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 80 22823882
2 142 22823882

Sequence

MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLLLIAMVKLNRSLSILAAQK

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0