Biotinidase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Biotinidase
  • GlycoProtDB: GPDB0006678
  • UniProt ID: Q8CIF4
  • Gene Symbol: Btd
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 96 17406563
22823882
2 127 17406563
22823882
3 180 17406563
22823882
4 326 17406563
22823882
23002422

Sequence

MSGARTAPALFFLGCSALALGVSSASQEHREAEYYVAAVYEHPSVLSPNPLELVSRQEALELMKQNLDVYEQQVMAAAQKGVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPKLVRWNPCLEPFRFNDTEVLQRLSCMAIKGGMFLVANLGTKQPCLSSDPGCPQDGRYQFNTNVVFSDNGTLVDRYRKHNLYFEAAFDTPANVDLITFDTPFAGKFGVFTCFDILFFDPAVRLLRDFEVKHIVYPTAWMNQLPLLAAIEIQKAFATAFGVNVLAANIHHPTLGMTGSGIHTPLKSFWYHDMDDPKGHLIIAQVATNPQGLTGTGNTTSEMDPSHRKFLKILSGDPYCEKDAQEVHCDEAAKWNVNVPPTFHSEMMYDNFTLVPVWGTEGHLQVCSNSLCCHLLYERPTLSKELYALGVFDGLHTVHGTYYIQTCALVKCGGLGFDTCGQEITEAEGLFDFHLWGNFSTLYIFPLFLTSGMTLDTPDQLGWENDHYFLRKRGLSSGLVTAALYGRLYERK

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0