CD72 variant (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD72 variant (Fragment)
  • GlycoProtDB: GPDB0006694
  • UniProt ID: Q8CIX9
  • Gene Symbol: Cd72
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 61 23002422

Sequence

SVNSSALRQIPRCPTVCLQYFLLGLLVSCLMLGVAVICLGVRXXQXSXQFQEGTRIWEATNSSLQQQLREKISQLGQKEVELQKARKELISSQDTLQEKQRTHEDAEQQLQACQAERAKTKENLKTEEERRRDLDHRLTSTRETLRRFFSDSSDTCCPCGWIPYQERGFYISHTLGSLEESQKYCTSLSSKRQQSKKPPKINKKNPPDAPQVSLPSGLEELLDRSKSYWIQMSKKWRQDSDSQSRHCVRIKTYYQKWERTISKCAELHPCICESEAFRFPDGINLN

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0