CD209 antigen-like protein B

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD209 antigen-like protein B
  • GlycoProtDB: GPDB0006698
  • UniProt ID: Q8CJ85
  • Gene Symbol: Cd209b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 112 23002422
2 141 23002422

Sequence

MSDSTEAKMQPLSSMDDDELMVSGSRYSIKSSRLRPNSGIKCLAGCSGHSQVPLVLQLLSFLFLAGLLLIILFQVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELYLPAADF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0