C-type lectin domain family 4, member a3

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 4, member a3
  • GlycoProtDB: GPDB0006715
  • UniProt ID: Q8JZX6
  • Gene Symbol: Clec4a3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 86 23002422

Sequence

MFSENIYVNTNFKNKVDSSDIDTDSWPAPQRKNTSQKSCHKFSKVLFTSLIIYFLLLTILFSGALITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTFWHKGEPSSDNEQCVIINHRQSTGWGWSDIPCSDKQNSICHVKKIYL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0