Beta-mannosidase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Beta-mannosidase
  • GlycoProtDB: GPDB0006772
  • UniProt ID: Q8K2I4
  • Gene Symbol: Manba
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 89 17406563
22823882
23002422
2 297 22823882
23002422
3 302 22823882
23002422

Sequence

MHLHLLLILALFRAGCVVAGPSYSLSGSWRVSNGNGSLELPATVPGYVHSALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDITNVVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYNIAHLDYLTFLPVYDNASQAWNIEIKASFDVASSKSVGGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKIRKDVAVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSFQDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLEKVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHFKLPQGTDPLRTFKDTIYLTQVMQAQCIKTETEFYLRSRSEIVDGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDEGVFYVYGVSDLHKDHHTQLTVRLHHWSSPKPLCSLVNSSIVVKAGEAVVLFQMPVSELLKRCRGCTRETCVVSFYFSTDKELFSPTNYHFLSSLKDAKGLLEANITVNISQKGNVFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKSELQQAFSVTSLTDTY

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0