4732418C07Rik protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
4732418C07Rik protein (Fragment)
  • GlycoProtDB: GPDB0006817
  • UniProt ID: Q8R053
  • Gene Symbol: Efcab14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 125 17406563
22823882
23002422
2 148 22823882
3 169 22823882
23002422

Sequence

LKASVKSAADLLSLPSTVEGLQKSVASIGNTLNSVHLAVEVIQKTVDEHRTTLGLLQGSMENNGSNQILPSPSPPSELDNKSHSESAKQDILYLHNSLEEVNSTVVEYQRQNDLKLKGMSETLSNLTQRLSLIESHVVALSKAEQRTNVSSSTMENRAATLKRESLVTNRSDTVQAQSMKKEDNSNSQVSELREKLQLISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPLSLPGISSIKDLQDLFHKTGQDVDGMLTYQELWNSLGSAMPRPESLRAFDSNGDGRYSFLELRLALGI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0