2210023G05Rik protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
2210023G05Rik protein (Fragment)
  • GlycoProtDB: GPDB0006828
  • UniProt ID: Q8R0L2
  • Gene Symbol: Ces2g
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 84 17406563
22823882
23002422

Sequence

DAWEDIEDPKTLQIQFTEMMEDFMFVIPSLQVAYFQRSHAPVYFYEFQHQSSFLKDVRPPHVNADHGDEVPFVFGSFFWGMKLNLTEEEKLLNRRMMKYWANFARHGNPNSESLPYWPVFDHDEQYLQLNIQPAVGQFQKARKLQFWTKTLPRKIEELKRSQNVHKEL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0