Abca7 protein (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Abca7 protein (Fragment)
  • GlycoProtDB: GPDB0006847
  • UniProt ID: Q8R1I3
  • Gene Symbol: Abca7
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 162 23002422

Sequence

GARPQESDQPTSQGSVTKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACSEFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPTRPKQ

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0