Bone marrow stromal antigen 2

Entry of glycoprotein extracted from GlycoProtDB


Summary
Bone marrow stromal antigen 2
  • GlycoProtDB: GPDB0006859
  • UniProt ID: Q8R2Q8
  • Gene Symbol: Bst2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 70 17406563
22823882
23002422
2 97 ---

Sequence

MAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVVTLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSSLLVLKVSLFLLF

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0