C-type lectin domain family 14 member A

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 14 member A
  • GlycoProtDB: GPDB0006956
  • UniProt ID: Q8VCP9
  • Gene Symbol: Clec14a
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 189 17406563
22823882
23002422

Sequence

MRPALALCLLCPAFWPRPGNGEHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSSTVVFILVSIAVIVLVVLTITVLGLFKLCFHKSRSSRTGKGALDSPGVECDAEATSLHHSSTQCTDIGVKSGTVA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0