Alpha-1-acid glycoprotein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-1-acid glycoprotein
  • GlycoProtDB: GPDB0007073
  • UniProt ID: Q91X23
  • Gene Symbol: Orm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 94 17406563
22823882
23002422
2 104 22823882
23002422

Sequence

MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELQEVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0