Agrin (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Agrin (Fragment)
  • GlycoProtDB: GPDB0007090
  • UniProt ID: Q91XS3
  • Gene Symbol: Agrn
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 137 ---

Sequence

MVRPRLSFPAPLLPLLLLLAAAAPAVPGATGTCPERALERRKEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGIHFTAAPSMPPDVCRGMLCGFGAVCEPSV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0